SCOP 1.71: Domain d1cf8h2: 1cf8 H:114-215

Lineage for d1cf8h2 (1cf8 H:114-215)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1cf8h2: 1cf8 H:114-215 [21371]
   Other proteins in same PDB: d1cf8h1, d1cf8l1, d1cf8l2
   part of catalytic Fab HA-19A4 with a polyene cyclase activity
   complexed with cd, haz

Details for d1cf8h2

PDB Entry: 1cf8, 2.7 Å

PDB Description: Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions

SCOP Domain Sequences for d1cf8h2:

Sequence; same for both SEQRES and ATOM records:

>d1cf8h2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsd
lytmsssvtvpsstwpsqtvtcsvahpassttvdkklepkdc

Timeline for d1cf8h2:

• d1cf8h2 first appeared (with stable ids) in SCOP 1.55
  
• d1cf8h2 appears in SCOP 1.69
  
• d1cf8h2 appears in SCOP 1.73
  
• d1cf8h2 appears in the current release, SCOPe 2.08