SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3n3qa2 (3n3q A:444-748)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002950Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 protein domains)
    duplication: tandem repeat of two CCP-like domains
  6. 2002951Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 2002952Species Burkholderia pseudomallei [TaxId:28450] [89093] (21 PDB entries)
    Uniprot P13029 Q939D2 35-748
  8. 2003002Domain d3n3qa2: 3n3q A:444-748 [213703]
    automated match to d2ccaa2
    complexed with cl, hem, mpd, mrd, na, niz

Details for d3n3qa2

PDB Entry: 3n3q (more details), 1.9 Å

PDB Description: crystal structure of the s324t variant of burkholderia pseudomallei katg with isonicotinic acid hydrazide bound
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d3n3qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n3qa2 a.93.1.3 (A:444-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
llwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgganga
rirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaa
knaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaql
ltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadad
vfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnld
rfdla

SCOPe Domain Coordinates for d3n3qa2:

Click to download the PDB-style file with coordinates for d3n3qa2.
(The format of our PDB-style files is described here.)

Timeline for d3n3qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n3qa1