SCOPe 2.06: Domain d3n3pb1: 3n3p B:35-443

Lineage for d3n3pb1 (3n3p B:35-443)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 proteins)
   duplication: tandem repeat of two CCP-like domains

6. Protein Catalase-peroxidase KatG [74754] (4 species)
   only the N-terminal CCP-like domain binds heme

7. Species Burkholderia pseudomallei [TaxId:28450] [89093] (21 PDB entries)
   Uniprot P13029 Q939D2 35-748

8. Domain d3n3pb1: 3n3p B:35-443 [213700]
   automated match to d1sj2a1
   complexed with amp, cl, hem, mpd, mrd, na, niz, po4

Details for d3n3pb1

PDB Entry: 3n3p, 1.89 Å

PDB Description: crystal structure of catalase-peroxidase katg with isonicotinic acid hydrazide and amp bound

PDB Compounds: (B:) Catalase-peroxidase

SCOPe Domain Sequences for d3n3pb1:

Sequence; same for both SEQRES and ATOM records:

>d3n3pb1 a.93.1.3 (B:35-443) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaev

Timeline for d3n3pb1:

• d3n3pb1 first appeared in SCOPe 2.03
  
• d3n3pb1 appears in SCOPe 2.05
  
• d3n3pb1 does not appear in SCOPe 2.07