SCOPe 2.05: Domain d1cf8l2: 1cf8 L:108-214

Lineage for d1cf8l2 (1cf8 L:108-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (346 PDB entries)
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

8. Domain d1cf8l2: 1cf8 L:108-214 [21370]
   Other proteins in same PDB: d1cf8h1, d1cf8h2, d1cf8l1
   part of catalytic Fab HA-19A4 with a polyene cyclase activity
   complexed with cd, haz

Details for d1cf8l2

PDB Entry: 1cf8, 2.7 Å

PDB Description: Convergence of catalytic antibody and terpene cyclase mechanisms: polyene cyclization directed by carbocation-pi interactions

PDB Compounds: (L:) protein (catalytic antibody 19a4 (light chain))

SCOPe Domain Sequences for d1cf8l2:

Sequence; same for both SEQRES and ATOM records:

>d1cf8l2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radvaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1cf8l2:

• d1cf8l2 first appeared (with stable ids) in SCOP 1.55
  
• d1cf8l2 appears in SCOPe 2.04
  
• d1cf8l2 appears in SCOPe 2.06
  
• d1cf8l2 appears in the current release, SCOPe 2.08