SCOP 1.75: Domain d3fctd2: 3fct D:115-216

Lineage for d3fctd2 (3fct D:115-216)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
SQ NA # humanized antibody
Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
SQ NA # engineered antibody
including humanized antibodies (chimeric proteins with human constant domains)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

Domain d3fctd2: 3fct D:115-216 [21369]
Other proteins in same PDB: d3fcta1, d3fcta2, d3fctb1, d3fctc1, d3fctc2, d3fctd1
part of metal chelatase catalytic Fab 7G12; mature antibody
complexed with ca, cd, mg, mmp, na

Details for d3fctd2

PDB Entry: 3fct (more details), 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

PDB Compounds: (D:) protein (metal chelatase catalytic antibody)

SCOP Domain Sequences for d3fctd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fctd2 b.1.1.2 (D:115-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkivpks

SCOP Domain Coordinates for d3fctd2:

Click to download the PDB-style file with coordinates for d3fctd2.
(The format of our PDB-style files is described here.)

Timeline for d3fctd2: