Lineage for d3fctd2 (3fct D:115-216)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9262Species Mature metal chelatase catalytic Fab, (human), kappa L chain [49089] (1 PDB entry)
  8. 9266Domain d3fctd2: 3fct D:115-216 [21369]
    Other proteins in same PDB: d3fcta1, d3fctb1, d3fctc1, d3fctd1

Details for d3fctd2

PDB Entry: 3fct (more details), 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten
PDB Compounds: (D:)

SCOP Domain Sequences for d3fctd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fctd2 b.1.1.2 (D:115-216) Immunoglobulin (constant domains of L and H chains) {Mature metal chelatase catalytic Fab, (human), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkivpks

SCOP Domain Coordinates for d3fctd2:

Click to download the PDB-style file with coordinates for d3fctd2.
(The format of our PDB-style files is described here.)

Timeline for d3fctd2: