![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Mature metal chelatase catalytic Fab, (human), kappa L chain [49089] (1 PDB entry) |
![]() | Domain d3fctd2: 3fct D:115-216 [21369] Other proteins in same PDB: d3fcta1, d3fctb1, d3fctc1, d3fctd1 |
PDB Entry: 3fct (more details), 2.4 Å
SCOP Domain Sequences for d3fctd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fctd2 b.1.1.2 (D:115-216) Immunoglobulin (constant domains of L and H chains) {Mature metal chelatase catalytic Fab, (human), kappa L chain} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkivpks
Timeline for d3fctd2: