Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (32 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [226764] (1 PDB entry) |
Domain d3n2le_: 3n2l E: [213682] Other proteins in same PDB: d3n2lb2 automated match to d2przb_ complexed with cl |
PDB Entry: 3n2l (more details), 2.1 Å
SCOPe Domain Sequences for d3n2le_:
Sequence, based on SEQRES records: (download)
>d3n2le_ c.61.1.0 (E:) automated matches {Vibrio cholerae [TaxId: 666]} mkayqrefiefalekqvlkfgeftlksgrkspyffnaglfntgrdlarlgrfyaaalvds giefdvlfgpaykgipiatttavaladhhdvdtpycfnrkeaknhgeggnlvgsklegrv mlvddvitagtairesmeliqankadlagvlvaidrqekgkgelsaiqeverdfgcavis ivsltdlityleqqgnntehleavkayraqygi
>d3n2le_ c.61.1.0 (E:) automated matches {Vibrio cholerae [TaxId: 666]} mkayqrefiefalekqvlkfgeftlksgrkspyffnaglfntgrdlarlgrfyaaalvds giefdvlfgpaykgipiatttavaladhhdvdtpycfnrkenlvgsklegrvmlvddvit agtairesmeliqankadlagvlvaidrqekgkgelsaiqeverdfgcavisivsltdli tyleqqgnntehleavkayraqygi
Timeline for d3n2le_: