SCOP 1.63: Domain d3fctc2: 3fct C:108-213

Lineage for d3fctc2 (3fct C:108-213)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Metal chelatase catalytic Fab 7G12, (human), kappa L chain [49089] (5 PDB entries)

8. Domain d3fctc2: 3fct C:108-213 [21368]
   Other proteins in same PDB: d3fcta1, d3fctb1, d3fctc1, d3fctd1

Details for d3fctc2

PDB Entry: 3fct, 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

SCOP Domain Sequences for d3fctc2:

Sequence; same for both SEQRES and ATOM records:

>d3fctc2 b.1.1.2 (C:108-213) Immunoglobulin (constant domains of L and H chains) {Metal chelatase catalytic Fab 7G12, (human), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne

Timeline for d3fctc2:

• d3fctc2 first appeared (with stable ids) in SCOP 1.55
  
• d3fctc2 appears in SCOP 1.61
  
• d3fctc2 appears in SCOP 1.65
  
• d3fctc2 appears in the current release, SCOPe 2.08