SCOPe 2.05: Domain d3n2lb_: 3n2l B:

Lineage for d3n2lb_ (3n2l B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (25 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [226764] (1 PDB entry)

8. Domain d3n2lb_: 3n2l B: [213679]
   automated match to d2przb_
   complexed with cl

Details for d3n2lb_

PDB Entry: 3n2l, 2.1 Å

PDB Description: 2.1 angstrom resolution crystal structure of an orotate phosphoribosyltransferase (pyre) from vibrio cholerae o1 biovar eltor str. n16961

PDB Compounds: (B:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d3n2lb_:

Sequence, based on SEQRES records:

>d3n2lb_ c.61.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
mmkayqrefiefalekqvlkfgeftlksgrkspyffnaglfntgrdlarlgrfyaaalvd
sgiefdvlfgpaykgipiatttavaladhhdvdtpycfnrkeaknhgeggnlvgsklegr
vmlvddvitagtairesmeliqankadlagvlvaidrqekgkgelsaiqeverdfgcavi
sivsltdlityleq

Sequence, based on observed residues (ATOM records):

>d3n2lb_ c.61.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
mmkayqrefiefalekqvlkfgeftlkrkspyffnaglfntgrdlarlgrfyaaalvdsg
iefdvlfgpaykgipiatttavaladhhdvdtpycfnrkenlvgsklegrvmlvddvita
gtairesmeliqankadlagvlvaidraiqeverdfgcavisivsltdlityleq

Timeline for d3n2lb_:

• d3n2lb_ first appeared in SCOPe 2.03
  
• d3n2lb_ appears in SCOPe 2.04
  
• d3n2lb_ is called d3n2lb1 in SCOPe 2.06
  
• d3n2lb_ appears in the current release, SCOPe 2.08, called d3n2lb1