Lineage for d3n2la_ (3n2l A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892172Species Vibrio cholerae [TaxId:666] [226764] (1 PDB entry)
  8. 2892173Domain d3n2la_: 3n2l A: [213678]
    Other proteins in same PDB: d3n2lb2
    automated match to d2przb_
    complexed with cl

Details for d3n2la_

PDB Entry: 3n2l (more details), 2.1 Å

PDB Description: 2.1 angstrom resolution crystal structure of an orotate phosphoribosyltransferase (pyre) from vibrio cholerae o1 biovar eltor str. n16961
PDB Compounds: (A:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d3n2la_:

Sequence, based on SEQRES records: (download)

>d3n2la_ c.61.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
mkayqrefiefalekqvlkfgeftlksgrkspyffnaglfntgrdlarlgrfyaaalvds
giefdvlfgpaykgipiatttavaladhhdvdtpycfnrkeaknhgeggnlvgsklegrv
mlvddvitagtairesmeliqankadlagvlvaidrqekgkgelsaiqeverdfgcavis
ivsltdlityleqqgnntehleavkayraqygi

Sequence, based on observed residues (ATOM records): (download)

>d3n2la_ c.61.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
mkayqrefiefalekqvlkfgeftlksgrkspyffnaglfntgrdlarlgrfyaaalvds
giefdvlfgpaykgipiatttavaladhhdvdtpycfnrkenlvgsklegrvmlvddvit
agtairesmeliqankadlagvlvaidrqekgkgelsaiqeverdfgcavisivsltdli
tyleqqgnntehleavkayraqygi

SCOPe Domain Coordinates for d3n2la_:

Click to download the PDB-style file with coordinates for d3n2la_.
(The format of our PDB-style files is described here.)

Timeline for d3n2la_: