Lineage for d3n2ib_ (3n2i B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123827Protein automated matches [190087] (10 species)
    not a true protein
  7. 2123898Species Vibrio cholerae [TaxId:243277] [225848] (2 PDB entries)
  8. 2123901Domain d3n2ib_: 3n2i B: [213677]
    automated match to d4tmka_
    complexed with cl, thm

Details for d3n2ib_

PDB Entry: 3n2i (more details), 2.25 Å

PDB Description: 2.25 angstrom resolution crystal structure of a thymidylate kinase (tmk) from vibrio cholerae o1 biovar eltor str. n16961 in complex with thymidine
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d3n2ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n2ib_ c.37.1.1 (B:) automated matches {Vibrio cholerae [TaxId: 243277]}
nakfivieglegagkstaiqvvvetlqqngidhitrtrepggtllaeklralvkeehpge
elqditelllvyaarvqlvenvikpalargewvvgdrhdmssqayqgggrqiapstmqsl
kqtalgdfkpdltlyldidpklglerargrgeldriekmdisfferarerylelansdds
vvmidaaqsieqvtadirralqdwlsqvn

SCOPe Domain Coordinates for d3n2ib_:

Click to download the PDB-style file with coordinates for d3n2ib_.
(The format of our PDB-style files is described here.)

Timeline for d3n2ib_: