Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein automated matches [190087] (8 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [225848] (2 PDB entries) |
Domain d3n2ib_: 3n2i B: [213677] automated match to d4tmka_ complexed with cl, thm |
PDB Entry: 3n2i (more details), 2.25 Å
SCOPe Domain Sequences for d3n2ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n2ib_ c.37.1.1 (B:) automated matches {Vibrio cholerae [TaxId: 243277]} nakfivieglegagkstaiqvvvetlqqngidhitrtrepggtllaeklralvkeehpge elqditelllvyaarvqlvenvikpalargewvvgdrhdmssqayqgggrqiapstmqsl kqtalgdfkpdltlyldidpklglerargrgeldriekmdisfferarerylelansdds vvmidaaqsieqvtadirralqdwlsqvn
Timeline for d3n2ib_: