![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein automated matches [190087] (15 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:243277] [225848] (2 PDB entries) |
![]() | Domain d3n2ia_: 3n2i A: [213676] automated match to d4tmka_ complexed with cl, thm |
PDB Entry: 3n2i (more details), 2.25 Å
SCOPe Domain Sequences for d3n2ia_:
Sequence, based on SEQRES records: (download)
>d3n2ia_ c.37.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} mnakfivieglegagkstaiqvvvetlqqngidhitrtrepggtllaeklralvkeehpg eelqditelllvyaarvqlvenvikpalargewvvgdrhdmssqayqgggrqiapstmqs lkqtalgdfkpdltlyldidpklglerargrgeldriekmdisfferarerylelansdd svvmidaaqsieqvtadirralqdwlsq
>d3n2ia_ c.37.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} mnakfivieglegagkstaiqvvvetlqqngidhitrtrepggtllaeklralvkeehpg eelqditelllvyaarvqlvenvikpalargewvvgdrhdmssqayqgggrqiapstmqs lkqtalgdfkpdltlyldidpklglerargeldriekmdisfferarerylelansddsv vmidaaqsieqvtadirralqdwlsq
Timeline for d3n2ia_: