SCOP 1.59: Domain d3fctb2: 3fct B:115-216

Lineage for d3fctb2 (3fct B:115-216)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Mature metal chelatase catalytic Fab, (human), kappa L chain [49089] (1 PDB entry)

8. Domain d3fctb2: 3fct B:115-216 [21367]
   Other proteins in same PDB: d3fcta1, d3fctb1, d3fctc1, d3fctd1

Details for d3fctb2

PDB Entry: 3fct, 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten

SCOP Domain Sequences for d3fctb2:

Sequence; same for both SEQRES and ATOM records:

>d3fctb2 b.1.1.2 (B:115-216) Immunoglobulin (constant domains of L and H chains) {Mature metal chelatase catalytic Fab, (human), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkivpks

Timeline for d3fctb2:

• d3fctb2 first appeared (with stable ids) in SCOP 1.55
  
• d3fctb2 appears in SCOP 1.57
  
• d3fctb2 appears in SCOP 1.61
  
• d3fctb2 appears in the current release, SCOPe 2.08