Lineage for d3n0fa2 (3n0f A:266-595)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2010972Species Populus tremula [TaxId:80863] [225928] (2 PDB entries)
  8. 2010973Domain d3n0fa2: 3n0f A:266-595 [213666]
    Other proteins in same PDB: d3n0fa1, d3n0fb1
    automated match to d1hxga2

Details for d3n0fa2

PDB Entry: 3n0f (more details), 2.7 Å

PDB Description: Crystal Structure of Isoprene Synthase from Grey Poplar Leaves (Populus x canescens)
PDB Compounds: (A:) Isoprene synthase

SCOPe Domain Sequences for d3n0fa2:

Sequence, based on SEQRES records: (download)

>d3n0fa2 a.128.1.0 (A:266-595) automated matches {Populus tremula [TaxId: 80863]}
nqvllelaildynmiqsvyqrdlretsrwwrrvglatklhfardrliesfywavgvafep
qysdcrnsvakmfsfvtiiddiydvygtldelelftdaverwdvnaindlpdymklcfla
lyntineiaydnlkdkgenilpyltkawadlcnaflqeakwlynkstptfddyfgnawks
ssgplqlifayfavvqnikkeeienlqkyhdiisrpshifrlcndlasasaeiargetan
svscymrtkgiseelatesvmnlidetwkkmnkeklggslfakpfvetainlarqshcty
hngdahtspdeltrkrvlsvitepilpfer

Sequence, based on observed residues (ATOM records): (download)

>d3n0fa2 a.128.1.0 (A:266-595) automated matches {Populus tremula [TaxId: 80863]}
nqvllelaildynmiqsvyqrdlretsrwwrrvglatklhfardrliesfywavgvafep
qysdcrnsvakmfsfvtiiddiydvygtldelelftdaverwdvnaindlpdymklcfla
lyntineiaydnlkdkgenilpyltkawadlcnaflqeakwlynkstptfddyfgnawks
ssgplqlifayfavvqnikkeeienlqkyhdiisrpshifrlcndlasasaeiargetan
svscymrtkgiseelatesvmnlidetwkkmnkeklggslfakpfvetainlarqshcty
hngtspdeltrkrvlsvitepilpfer

SCOPe Domain Coordinates for d3n0fa2:

Click to download the PDB-style file with coordinates for d3n0fa2.
(The format of our PDB-style files is described here.)

Timeline for d3n0fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n0fa1