Lineage for d3n0fa1 (3n0f A:57-265)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1277308Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 1277309Protein automated matches [226931] (6 species)
    not a true protein
  7. 1277323Species Populus tremula [TaxId:80863] [225927] (2 PDB entries)
  8. 1277324Domain d3n0fa1: 3n0f A:57-265 [213665]
    Other proteins in same PDB: d3n0fa2, d3n0fb2
    automated match to d1hxga1

Details for d3n0fa1

PDB Entry: 3n0f (more details), 2.7 Å

PDB Description: Crystal Structure of Isoprene Synthase from Grey Poplar Leaves (Populus x canescens)
PDB Compounds: (A:) Isoprene synthase

SCOPe Domain Sequences for d3n0fa1:

Sequence, based on SEQRES records: (download)

>d3n0fa1 a.102.4.0 (A:57-265) automated matches {Populus tremula [TaxId: 80863]}
sadyepnswdydfllssdtdesievykdkakkleaevrreinnekaefltllelidnvqr
lglgyrfesdirraldrfvssggfdgvtktslhatalsfrllrqhgfevsqeafsgfkdq
ngnflenlkedtkailslyeasflalegenildearvfaishlkelseekigkelaeqvn
halelplhrrtqrleavwsieayrkkeda

Sequence, based on observed residues (ATOM records): (download)

>d3n0fa1 a.102.4.0 (A:57-265) automated matches {Populus tremula [TaxId: 80863]}
sadyepnswdydfllssievykdkakkleaevrreinnekaefltllelidnvqrlglgy
rfesdirraldrfvssggfdgvtktslhatalsfrllrqhgfevsqeafsgfkdqngnfl
enlkedtkailslyeasflalegenildearvfaishlkelseekigkelaeqvnhalel
plhrrtqrleavwsieayrkkeda

SCOPe Domain Coordinates for d3n0fa1:

Click to download the PDB-style file with coordinates for d3n0fa1.
(The format of our PDB-style files is described here.)

Timeline for d3n0fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3n0fa2