SCOPe 2.06: Domain d3mzga_: 3mzg A:

Lineage for d3mzga_ (3mzg A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein automated matches [190263] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187052] (12 PDB entries)

8. Domain d3mzga_: 3mzg A: [213663]
   Other proteins in same PDB: d3mzgb1, d3mzgb2
   automated match to d3ncca_
   complexed with cl, na

Details for d3mzga_

PDB Entry: 3mzg, 2.1 Å

PDB Description: Crystal structure of a human prolactin receptor antagonist in complex with the extracellular domain of the human prolactin receptor

PDB Compounds: (A:) Prolactin

SCOPe Domain Sequences for d3mzga_:

Sequence; same for both SEQRES and ATOM records:

>d3mzga_ a.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatpedkeqaq
qmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrllermeli
vsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkllkcri
ihnnnc

Timeline for d3mzga_:

• d3mzga_ first appeared in SCOPe 2.03
  
• d3mzga_ appears in SCOPe 2.05
  
• d3mzga_ appears in SCOPe 2.07
  
• d3mzga_ appears in the current release, SCOPe 2.08