Lineage for d3fcta2 (3fct A:108-213)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221893Species Metal chelatase catalytic Fab 7G12, (human), kappa L chain [49089] (5 PDB entries)
  8. 221896Domain d3fcta2: 3fct A:108-213 [21366]
    Other proteins in same PDB: d3fcta1, d3fctb1, d3fctc1, d3fctd1

Details for d3fcta2

PDB Entry: 3fct (more details), 2.4 Å

PDB Description: mature metal chelatase catalytic antibody with hapten
PDB Compounds: (A:)

SCOP Domain Sequences for d3fcta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fcta2 b.1.1.2 (A:108-213) Immunoglobulin (constant domains of L and H chains) {Metal chelatase catalytic Fab 7G12, (human), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrne

SCOP Domain Coordinates for d3fcta2:

Click to download the PDB-style file with coordinates for d3fcta2.
(The format of our PDB-style files is described here.)

Timeline for d3fcta2: