SCOPe 2.03: Domain d3mz8b2: 3mz8 B:165-221

Lineage for d3mz8b2 (3mz8 B:165-221)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.19: Crisp domain-like [57545] (1 superfamily)
   disulfide-rich all-alpha fold

4. Superfamily g.19.1: Crisp domain-like [57546] (3 families)

5. Family g.19.1.0: automated matches [227153] (1 protein)
   not a true family

6. Protein automated matches [226858] (4 species)
   not a true protein

7. Species Chinese cobra (Naja atra) [TaxId:8656] [224985] (4 PDB entries)

8. Domain d3mz8b2: 3mz8 B:165-221 [213656]
   Other proteins in same PDB: d3mz8a1, d3mz8b1
   automated match to d1rc9a2
   complexed with zn

Details for d3mz8b2

PDB Entry: 3mz8, 2.7 Å

PDB Description: Crystal Structure of Zinc-Bound Natrin From Naja atra

PDB Compounds: (B:) Natrin-1

SCOPe Domain Sequences for d3mz8b2:

Sequence; same for both SEQRES and ATOM records:

>d3mz8b2 g.19.1.0 (B:165-221) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
ppcgdcpsacdnglctnpctiynkltncdsllkqsscqddwiksncpascfcrnkii

Timeline for d3mz8b2:

• d3mz8b2 is new in SCOPe 2.03-stable
  
• d3mz8b2 appears in SCOPe 2.04
  
• d3mz8b2 appears in the current release, SCOPe 2.08