SCOPe 2.04: Domain d3mz8b1: 3mz8 B:2-164

Lineage for d3mz8b1 (3mz8 B:2-164)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.111: PR-1-like [55796] (1 superfamily)
   alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342

4. Superfamily d.111.1: PR-1-like [55797] (2 families)

5. Family d.111.1.1: PR-1-like [55798] (5 proteins)
   Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1

6. Protein automated matches [194852] (3 species)
   not a true protein

7. Species Chinese cobra (Naja atra) [TaxId:8656] [224984] (4 PDB entries)

8. Domain d3mz8b1: 3mz8 B:2-164 [213655]
   Other proteins in same PDB: d3mz8a2, d3mz8b2
   automated match to d1rc9a1
   complexed with zn

Details for d3mz8b1

PDB Entry: 3mz8, 2.7 Å

PDB Description: Crystal Structure of Zinc-Bound Natrin From Naja atra

PDB Compounds: (B:) Natrin-1

SCOPe Domain Sequences for d3mz8b1:

Sequence; same for both SEQRES and ATOM records:

>d3mz8b1 d.111.1.1 (B:2-164) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
vdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhs
pdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivw
yqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklg

Timeline for d3mz8b1:

• d3mz8b1 first appeared in SCOPe 2.03
  
• d3mz8b1 appears in SCOPe 2.05
  
• d3mz8b1 appears in the current release, SCOPe 2.08