![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.19: Crisp domain-like [57545] (1 superfamily) disulfide-rich all-alpha fold |
![]() | Superfamily g.19.1: Crisp domain-like [57546] (3 families) ![]() |
![]() | Family g.19.1.0: automated matches [227153] (1 protein) not a true family |
![]() | Protein automated matches [226858] (4 species) not a true protein |
![]() | Species Chinese cobra (Naja atra) [TaxId:8656] [224985] (4 PDB entries) |
![]() | Domain d3mz8a2: 3mz8 A:165-221 [213654] Other proteins in same PDB: d3mz8a1, d3mz8b1 automated match to d1rc9a2 complexed with zn |
PDB Entry: 3mz8 (more details), 2.7 Å
SCOPe Domain Sequences for d3mz8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mz8a2 g.19.1.0 (A:165-221) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]} ppcgdcpsacdnglctnpctiynkltncdsllkqsscqddwiksncpascfcrnkii
Timeline for d3mz8a2: