Lineage for d3mz8a1 (3mz8 A:2-164)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2577754Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2577755Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2577756Family d.111.1.1: PR-1-like [55798] (5 proteins)
    Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
  6. 2577769Protein automated matches [194852] (4 species)
    not a true protein
  7. 2577770Species Chinese cobra (Naja atra) [TaxId:8656] [224984] (4 PDB entries)
  8. 2577775Domain d3mz8a1: 3mz8 A:2-164 [213653]
    Other proteins in same PDB: d3mz8a2, d3mz8b2
    automated match to d1rc9a1
    complexed with zn

Details for d3mz8a1

PDB Entry: 3mz8 (more details), 2.7 Å

PDB Description: Crystal Structure of Zinc-Bound Natrin From Naja atra
PDB Compounds: (A:) Natrin-1

SCOPe Domain Sequences for d3mz8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mz8a1 d.111.1.1 (A:2-164) automated matches {Chinese cobra (Naja atra) [TaxId: 8656]}
vdfnsestrrkkkqkeivdlhnslrrrvsptasnmlkmewypeaasnaerwantcslnhs
pdnlrvlegiqcgesiymssnartwteiihlwhdeyknfvygvganppgsvtghytqivw
yqtyragcavsycpssawsyfyvcqycpsgnfqgktatpyklg

SCOPe Domain Coordinates for d3mz8a1:

Click to download the PDB-style file with coordinates for d3mz8a1.
(The format of our PDB-style files is described here.)

Timeline for d3mz8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mz8a2