Lineage for d3my9a2 (3my9 A:130-373)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837289Species Azorhizobium caulinodans [TaxId:438753] [225921] (1 PDB entry)
  8. 2837290Domain d3my9a2: 3my9 A:130-373 [213649]
    Other proteins in same PDB: d3my9a1
    automated match to d1f9ca1
    complexed with gol, mg

Details for d3my9a2

PDB Entry: 3my9 (more details), 2.2 Å

PDB Description: crystal structure of a muconate cycloisomerase from azorhizobium caulinodans
PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3my9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3my9a2 c.1.11.0 (A:130-373) automated matches {Azorhizobium caulinodans [TaxId: 438753]}
rvrdriplsfsiadpdfdadlermramvpaghtvfkmktgvkphaeelriletmrgefge
ridlrldfnqaltpfgamkilrdvdafrptfieqpvprrhldamagfaaaldtpilades
cfdavdlmevvrrqaadaisvkimkcgglmkaqslmaiadtaglpgyggtlweggialaa
gtqliaatpgislgcefymphhvltedvleeriansaghvivpdgpglgisiseaslrgn
akil

SCOPe Domain Coordinates for d3my9a2:

Click to download the PDB-style file with coordinates for d3my9a2.
(The format of our PDB-style files is described here.)

Timeline for d3my9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3my9a1