SCOPe 2.05: Domain d3my9a1: 3my9 A:2-129

Lineage for d3my9a1 (3my9 A:2-129)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (83 species)
   not a true protein

7. Species Azorhizobium caulinodans [TaxId:438753] [225920] (1 PDB entry)

8. Domain d3my9a1: 3my9 A:2-129 [213648]
   Other proteins in same PDB: d3my9a2
   automated match to d1f9ca2
   complexed with gol, mg

Details for d3my9a1

PDB Entry: 3my9, 2.2 Å

PDB Description: crystal structure of a muconate cycloisomerase from azorhizobium caulinodans

PDB Compounds: (A:) Muconate cycloisomerase

SCOPe Domain Sequences for d3my9a1:

Sequence, based on SEQRES records:

>d3my9a1 d.54.1.0 (A:2-129) automated matches {Azorhizobium caulinodans [TaxId: 438753]}
swdsvveririflvespikmarlqgvgnvkgsvkrvllevtsadgivgwgeaapwevftg
tpeaafsaldiylrplilgapikrvrelmarmdkmlvghgeakaavemalldilgkatgl
svadllgg

Sequence, based on observed residues (ATOM records):

>d3my9a1 d.54.1.0 (A:2-129) automated matches {Azorhizobium caulinodans [TaxId: 438753]}
swdsvveririflvespikmgsvkrvllevtsadgivgwgeaapwtpeaafsaldiylrp
lilgapikrvrelmarmdkmlvghgeakaavemalldilgkatglsvadllgg

Timeline for d3my9a1:

• d3my9a1 first appeared in SCOPe 2.03
  
• d3my9a1 appears in SCOPe 2.04
  
• d3my9a1 appears in SCOPe 2.06
  
• d3my9a1 appears in the current release, SCOPe 2.08