Lineage for d2pcpc2 (2pcp C:108-211)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549856Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
  8. 550023Domain d2pcpc2: 2pcp C:108-211 [21364]
    Other proteins in same PDB: d2pcpa1, d2pcpb1, d2pcpb2, d2pcpc1, d2pcpd1, d2pcpd2
    part of Fab 6B5
    complexed with 1pc

Details for d2pcpc2

PDB Entry: 2pcp (more details), 2.2 Å

PDB Description: antibody fab complexed with phencyclidine
PDB Compounds: (C:)

SCOP Domain Sequences for d2pcpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcpc2 b.1.1.2 (C:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d2pcpc2:

Click to download the PDB-style file with coordinates for d2pcpc2.
(The format of our PDB-style files is described here.)

Timeline for d2pcpc2: