Lineage for d3my0n_ (3my0 N:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673984Protein automated matches [190091] (13 species)
    not a true protein
  7. 1674055Species Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries)
  8. 1674530Domain d3my0n_: 3my0 N: [213637]
    automated match to d2wota_
    complexed with ldn

Details for d3my0n_

PDB Entry: 3my0 (more details), 2.65 Å

PDB Description: crystal structure of the acvrl1 (alk1) kinase domain bound to ldn- 193189
PDB Compounds: (N:) Serine/threonine-protein kinase receptor R3

SCOPe Domain Sequences for d3my0n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3my0n_ d.144.1.7 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqrtvarqvalvecvgkgrygevwrglwhgesvavkifssrdeqswfreteiyntvllrh
dnilgfiasdmtsrnsstqlwlithyhehgslydflqrqtlephlalrlavsaacglahl
hveifgtqgkpaiahrdfksrnvlvksnlqcciadlglavmhsqgsdyldignnprvgtk
rymapevldeqirtdcfesykwtdiwafglvlweiarrtivngivedyrppfydvvpndp
sfedmkkvvcvdqqtptipnrlaadpvlsglaqmmrecwypnpsarltalrikktlqkis

SCOPe Domain Coordinates for d3my0n_:

Click to download the PDB-style file with coordinates for d3my0n_.
(The format of our PDB-style files is described here.)

Timeline for d3my0n_: