Lineage for d2pcpa2 (2pcp A:108-211)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221322Species Fab 6B5, (mouse), kappa L chain [49088] (1 PDB entry)
  8. 221323Domain d2pcpa2: 2pcp A:108-211 [21362]
    Other proteins in same PDB: d2pcpa1, d2pcpb1, d2pcpc1, d2pcpd1

Details for d2pcpa2

PDB Entry: 2pcp (more details), 2.2 Å

PDB Description: antibody fab complexed with phencyclidine

SCOP Domain Sequences for d2pcpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pcpa2 b.1.1.2 (A:108-211) Immunoglobulin (constant domains of L and H chains) {Fab 6B5, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d2pcpa2:

Click to download the PDB-style file with coordinates for d2pcpa2.
(The format of our PDB-style files is described here.)

Timeline for d2pcpa2: