Lineage for d3mxca_ (3mxc A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2572000Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 2572001Species Human (Homo sapiens) [TaxId:9606] [55564] (38 PDB entries)
  8. 2572033Domain d3mxca_: 3mxc A: [213619]
    automated match to d3n84b_

Details for d3mxca_

PDB Entry: 3mxc (more details), 2 Å

PDB Description: Structures of Grb2-SH2 Domain and AICD peptide Complexes Reveal a Conformational Switch and Their Functional Implications.
PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d3mxca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mxca_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdie

SCOPe Domain Coordinates for d3mxca_:

Click to download the PDB-style file with coordinates for d3mxca_.
(The format of our PDB-style files is described here.)

Timeline for d3mxca_: