SCOPe 2.08: Domain d3mx6b1: 3mx6 B:2-258

Lineage for d3mx6b1 (3mx6 B:2-258)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.0: automated matches [194833] (1 protein)
   not a true family

6. Protein automated matches [194834] (4 species)
   not a true protein

7. Species Rickettsia prowazekii [TaxId:782] [225901] (2 PDB entries)

8. Domain d3mx6b1: 3mx6 B:2-258 [213618]
   Other proteins in same PDB: d3mx6b2
   automated match to d3tb5b_
   complexed with met, mn, na

Details for d3mx6b1

PDB Entry: 3mx6, 1.7 Å

PDB Description: crystal structure of methionine aminopeptidase from rickettsia prowazekii bound to methionine

PDB Compounds: (B:) Methionine aminopeptidase

SCOPe Domain Sequences for d3mx6b1:

Sequence; same for both SEQRES and ATOM records:

>d3mx6b1 d.127.1.0 (B:2-258) automated matches {Rickettsia prowazekii [TaxId: 782]}
ikihtekdfikmraagklaaetldfitdhvkpnvttnslndlchnfitshnaipaplnyk
gfpksictsinhvvchgipndkplkngdivnidvtvildgwygdtsrmyyvgdvaikpkr
liqvtydammkgievvrpgaklgdigyaiqsyaekhnysvvrdytghgigrvfhdkpsil
nygrngtgltlkegmfftvepminagnydtilskldgwtvttrdkslsaqfehtigvtkd
gfeiftlspkkldyppy

Timeline for d3mx6b1:

• d3mx6b1 first appeared in SCOPe 2.03, called d3mx6b_
  
• d3mx6b1 appears in SCOPe 2.07