SCOPe 2.06: Domain d3mwkb_: 3mwk B:

Lineage for d3mwkb_ (3mwk B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [187453] (13 PDB entries)

8. Domain d3mwkb_: 3mwk B: [213614]
   automated match to d1q0ua_
   protein/RNA complex; complexed with 8op, so4; mutant

Details for d3mwkb_

PDB Entry: 3mwk, 1.45 Å

PDB Description: Q28E mutant of HERA N-terminal RecA-like domain, complex with 8-oxo-AMP

PDB Compounds: (B:) heat resistant RNA dependent ATPase

SCOPe Domain Sequences for d3mwkb_:

Sequence; same for both SEQRES and ATOM records:

>d3mwkb_ c.37.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 262724]}
mefkdfplkpeilealhgrglttptpieaaalplalegkdligqartgtgktlafalpia
erlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrg
adavvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtll
fsatlpswakrlaerymknpvlinvik

Timeline for d3mwkb_:

• d3mwkb_ first appeared in SCOPe 2.03
  
• d3mwkb_ appears in SCOPe 2.05
  
• d3mwkb_ appears in SCOPe 2.07
  
• d3mwkb_ appears in the current release, SCOPe 2.08