Lineage for d3mwja_ (3mwj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2873046Species Thermus thermophilus [TaxId:262724] [187453] (15 PDB entries)
  8. 2873047Domain d3mwja_: 3mwj A: [213611]
    automated match to d1q0ua_
    complexed with so4; mutant

Details for d3mwja_

PDB Entry: 3mwj (more details), 1.4 Å

PDB Description: Q28E mutant of HERA N-terminal RecA-like domain, apo form
PDB Compounds: (A:) heat resistant RNA dependent ATPase

SCOPe Domain Sequences for d3mwja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mwja_ c.37.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}
mefkdfplkpeilealhgrglttptpieaaalplalegkdligqartgtgktlafalpia
erlapsqergrkpralvltptrelalqvaseltavaphlkvvavyggtgygkqkeallrg
adavvatpgraldylrqgvldlsrvevavldeademlsmgfeeeveallsatppsrqtll
fsatlpswakrlaerymknpvlinvik

SCOPe Domain Coordinates for d3mwja_:

Click to download the PDB-style file with coordinates for d3mwja_.
(The format of our PDB-style files is described here.)

Timeline for d3mwja_: