Lineage for d1sm3h2 (1sm3 H:114-213)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1292198Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1292510Species Mouse (Mus musculus) [TaxId:10090] [88576] (414 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 1292627Domain d1sm3h2: 1sm3 H:114-213 [21361]
    Other proteins in same PDB: d1sm3h1, d1sm3l1, d1sm3l2
    part of tumor-specific Fab SM3 against epithelial mucin Muc1
    complexed with cd, cl

Details for d1sm3h2

PDB Entry: 1sm3 (more details), 1.95 Å

PDB Description: crystal structure of the tumor specific antibody sm3 complex with its peptide epitope
PDB Compounds: (H:) sm3 antibody

SCOPe Domain Sequences for d1sm3h2:

Sequence, based on SEQRES records: (download)

>d1sm3h2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttpptvyplapgsnaasqsmvtlgclvkgyfpepvtvtwnsgslasgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdakivpr

Sequence, based on observed residues (ATOM records): (download)

>d1sm3h2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttpptvyplapgsmvtlgclvkgyfpepvtvtwnsgslasgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdakivpr

SCOPe Domain Coordinates for d1sm3h2:

Click to download the PDB-style file with coordinates for d1sm3h2.
(The format of our PDB-style files is described here.)

Timeline for d1sm3h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sm3h1