SCOPe 2.03: Domain d3mvqf2: 3mvq F:209-501

Lineage for d3mvqf2 (3mvq F:209-501)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Glutamate dehydrogenase [51884] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [51889] (6 PDB entries)

8. Domain d3mvqf2: 3mvq F:209-501 [213606]
   Other proteins in same PDB: d3mvqa1, d3mvqb1, d3mvqc1, d3mvqd1, d3mvqe1, d3mvqf1
   automated match to d3mw9a1
   complexed with glu, gtp, ndp, zn

Details for d3mvqf2

PDB Entry: 3mvq, 2.94 Å

PDB Description: bovine glutamate dehydrogenase complexed with zinc

PDB Compounds: (F:) Glutamate dehydrogenase 1, mitochondrial

SCOPe Domain Sequences for d3mvqf2:

Sequence; same for both SEQRES and ATOM records:

>d3mvqf2 c.2.1.7 (F:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfvvqgfgnvglhsmrylhrfga
kcitvgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlnn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

Timeline for d3mvqf2:

• d3mvqf2 is new in SCOPe 2.03-stable
  
• d3mvqf2 appears in SCOPe 2.04
  
• d3mvqf2 appears in the current release, SCOPe 2.08