Lineage for d3mvqf1 (3mvq F:1-208)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1376891Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1376892Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1376893Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 1376894Protein Glutamate dehydrogenase [53225] (8 species)
  7. 1376902Species Cow (Bos taurus) [TaxId:9913] [53230] (6 PDB entries)
  8. 1376914Domain d3mvqf1: 3mvq F:1-208 [213605]
    Other proteins in same PDB: d3mvqa2, d3mvqb2, d3mvqc2, d3mvqd2, d3mvqe2, d3mvqf2
    automated match to d3mw9a2
    complexed with glu, gtp, ndp, zn

Details for d3mvqf1

PDB Entry: 3mvq (more details), 2.94 Å

PDB Description: bovine glutamate dehydrogenase complexed with zinc
PDB Compounds: (F:) Glutamate dehydrogenase 1, mitochondrial

SCOPe Domain Sequences for d3mvqf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mvqf1 c.58.1.1 (F:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d3mvqf1:

Click to download the PDB-style file with coordinates for d3mvqf1.
(The format of our PDB-style files is described here.)

Timeline for d3mvqf1: