![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins) dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet |
![]() | Protein Glutamate dehydrogenase [53225] (8 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [53230] (6 PDB entries) |
![]() | Domain d3mvqd1: 3mvq D:1-208 [213601] Other proteins in same PDB: d3mvqa2, d3mvqb2, d3mvqc2, d3mvqd2, d3mvqe2, d3mvqf2 automated match to d3mw9a2 complexed with glu, gtp, ndp, zn |
PDB Entry: 3mvq (more details), 2.94 Å
SCOPe Domain Sequences for d3mvqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mvqd1 c.58.1.1 (D:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia dtyastighydinahacvtgkpisqggi
Timeline for d3mvqd1: