Lineage for d3mvqa1 (3mvq A:1-208)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890284Family c.58.1.1: Aminoacid dehydrogenases [53224] (4 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 2890285Protein Glutamate dehydrogenase [53225] (8 species)
  7. 2890293Species Cow (Bos taurus) [TaxId:9913] [53230] (6 PDB entries)
  8. 2890309Domain d3mvqa1: 3mvq A:1-208 [213595]
    Other proteins in same PDB: d3mvqa2, d3mvqb2, d3mvqc2, d3mvqd2, d3mvqe2, d3mvqf2
    automated match to d3mw9a2
    complexed with glu, gtp, ndp, zn

Details for d3mvqa1

PDB Entry: 3mvq (more details), 2.94 Å

PDB Description: bovine glutamate dehydrogenase complexed with zinc
PDB Compounds: (A:) Glutamate dehydrogenase 1, mitochondrial

SCOPe Domain Sequences for d3mvqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mvqa1 c.58.1.1 (A:1-208) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
adreddpnffkmvegffdrgasivedklvedlktreteeqkrnrvrsilriikpcnhvls
lsfpirrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdv
pfggakagvkinpknytdnelekitrrftmelakkgfigpgvdvpapdmstgeremswia
dtyastighydinahacvtgkpisqggi

SCOPe Domain Coordinates for d3mvqa1:

Click to download the PDB-style file with coordinates for d3mvqa1.
(The format of our PDB-style files is described here.)

Timeline for d3mvqa1: