Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins) |
Protein Adenosine deaminase (ADA) [51558] (4 species) Common fold covers the whole protein structure |
Species Mouse (Mus musculus) [TaxId:10090] [51559] (10 PDB entries) |
Domain d3mvib_: 3mvi B: [213591] automated match to d1a4ma_ complexed with gol, zn |
PDB Entry: 3mvi (more details), 1.6 Å
SCOPe Domain Sequences for d3mvib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mvib_ c.1.9.1 (B:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]} tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
Timeline for d3mvib_: