Lineage for d3mugk2 (3mug K:108-213)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (765 PDB entries)
  8. 2353319Domain d3mugk2: 3mug K:108-213 [213587]
    Other proteins in same PDB: d3muga1, d3mugc1, d3muge1, d3mugg1, d3mugi1, d3mugk1
    automated match to d1aqkl2
    complexed with nag

Details for d3mugk2

PDB Entry: 3mug (more details), 2.49 Å

PDB Description: crystal structure of human fab pg16, a broadly reactive and potent hiv-1 neutralizing antibody
PDB Compounds: (K:) Antibody PG16 Light Chain

SCOPe Domain Sequences for d3mugk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mugk2 b.1.1.2 (K:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvapte

SCOPe Domain Coordinates for d3mugk2:

Click to download the PDB-style file with coordinates for d3mugk2.
(The format of our PDB-style files is described here.)

Timeline for d3mugk2: