Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
Domain d3muge2: 3mug E:108-212 [213581] Other proteins in same PDB: d3muga1, d3mugc1, d3muge1, d3mugg1, d3mugi1, d3mugk1 automated match to d1aqkl2 complexed with nag |
PDB Entry: 3mug (more details), 2.49 Å
SCOPe Domain Sequences for d3muge2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3muge2 b.1.1.2 (E:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq snnkyaassylsltpeqwkshksyscqvthegstvektvapt
Timeline for d3muge2: