SCOPe 2.08: Domain d3muge1: 3mug E:3-107

Lineage for d3muge1 (3mug E:3-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3muge1: 3mug E:3-107 [213580]
   Other proteins in same PDB: d3muga2, d3mugb_, d3mugc2, d3mugd_, d3muge2, d3mugf_, d3mugg2, d3mugh_, d3mugi2, d3mugj_, d3mugk2, d3mugl_
   automated match to d1aqkl1
   complexed with nag

Details for d3muge1

PDB Entry: 3mug, 2.49 Å

PDB Description: crystal structure of human fab pg16, a broadly reactive and potent hiv-1 neutralizing antibody

PDB Compounds: (E:) Antibody PG16 Light Chain

SCOPe Domain Sequences for d3muge1:

Sequence; same for both SEQRES and ATOM records:

>d3muge1 b.1.1.0 (E:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
altqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgisn
rfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlg

Timeline for d3muge1:

• d3muge1 first appeared in SCOPe 2.03
  
• d3muge1 appears in SCOPe 2.07