SCOPe 2.03: Domain d3mugc1: 3mug C:2-107

Lineage for d3mugc1 (3mug C:2-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d3mugc1: 3mug C:2-107 [213578]
   Other proteins in same PDB: d3muga2, d3mugc2, d3muge2, d3mugg2, d3mugi2, d3mugk2
   automated match to d1aqkl1
   complexed with nag

Details for d3mugc1

PDB Entry: 3mug, 2.49 Å

PDB Description: crystal structure of human fab pg16, a broadly reactive and potent hiv-1 neutralizing antibody

PDB Compounds: (C:) Antibody PG16 Light Chain

SCOPe Domain Sequences for d3mugc1:

Sequence; same for both SEQRES and ATOM records:

>d3mugc1 b.1.1.0 (C:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgis
nrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlg

Timeline for d3mugc1:

• d3mugc1 is new in SCOPe 2.03-stable
  
• d3mugc1 appears in SCOPe 2.04
  
• d3mugc1 appears in the current release, SCOPe 2.08