Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries) |
Domain d3mugc1: 3mug C:2-107 [213578] Other proteins in same PDB: d3muga2, d3mugc2, d3muge2, d3mugg2, d3mugi2, d3mugk2 automated match to d1aqkl1 complexed with nag |
PDB Entry: 3mug (more details), 2.49 Å
SCOPe Domain Sequences for d3mugc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mugc1 b.1.1.0 (C:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} saltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgis nrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlg
Timeline for d3mugc1: