Lineage for d3mugc1 (3mug C:2-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756637Domain d3mugc1: 3mug C:2-107 [213578]
    Other proteins in same PDB: d3muga2, d3mugb_, d3mugc2, d3mugd_, d3muge2, d3mugf_, d3mugg2, d3mugh_, d3mugi2, d3mugj_, d3mugk2, d3mugl_
    automated match to d1aqkl1
    complexed with nag

Details for d3mugc1

PDB Entry: 3mug (more details), 2.49 Å

PDB Description: crystal structure of human fab pg16, a broadly reactive and potent hiv-1 neutralizing antibody
PDB Compounds: (C:) Antibody PG16 Light Chain

SCOPe Domain Sequences for d3mugc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mugc1 b.1.1.0 (C:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqpasvsgspgqtitiscngtssdvggfdsvswyqqspgkapkvmvfdvshrpsgis
nrfsgsksgntasltisglhiedegdyfcssltdrshrifgggtkvtvlg

SCOPe Domain Coordinates for d3mugc1:

Click to download the PDB-style file with coordinates for d3mugc1.
(The format of our PDB-style files is described here.)

Timeline for d3mugc1: