Lineage for d3mtqb1 (3mtq B:1-131)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883312Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883313Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 2883344Family c.54.1.0: automated matches [191356] (1 protein)
    not a true family
  6. 2883345Protein automated matches [190395] (8 species)
    not a true protein
  7. 2883358Species Klebsiella pneumoniae [TaxId:272620] [225902] (1 PDB entry)
  8. 2883360Domain d3mtqb1: 3mtq B:1-131 [213575]
    Other proteins in same PDB: d3mtqa2, d3mtqb2
    automated match to d3lfhe_

Details for d3mtqb1

PDB Entry: 3mtq (more details), 1.7 Å

PDB Description: crystal structure of a putative phosphoenolpyruvate-dependent sugar phosphotransferase system (pts) permease (kpn_04802) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.70 a resolution
PDB Compounds: (B:) putative phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) permease

SCOPe Domain Sequences for d3mtqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mtqb1 c.54.1.0 (B:1-131) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mkrhyifashgsfangllnsvelilgkqpdihtlcayveeevdltqqvealvarfpaqde
livitdifagsvnnefvrflsrphfhllsglnlpliidllisaaednteklitealtnak
esiqycnqtia

SCOPe Domain Coordinates for d3mtqb1:

Click to download the PDB-style file with coordinates for d3mtqb1.
(The format of our PDB-style files is described here.)

Timeline for d3mtqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mtqb2