SCOPe 2.08: Domain d3mtqb1: 3mtq B:1-131

Lineage for d3mtqb1 (3mtq B:1-131)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.0: automated matches [191356] (1 protein)
   not a true family

6. Protein automated matches [190395] (8 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [225902] (1 PDB entry)

8. Domain d3mtqb1: 3mtq B:1-131 [213575]
   Other proteins in same PDB: d3mtqa2, d3mtqb2
   automated match to d3lfhe_

Details for d3mtqb1

PDB Entry: 3mtq, 1.7 Å

PDB Description: crystal structure of a putative phosphoenolpyruvate-dependent sugar phosphotransferase system (pts) permease (kpn_04802) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.70 a resolution

PDB Compounds: (B:) putative phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) permease

SCOPe Domain Sequences for d3mtqb1:

Sequence; same for both SEQRES and ATOM records:

>d3mtqb1 c.54.1.0 (B:1-131) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mkrhyifashgsfangllnsvelilgkqpdihtlcayveeevdltqqvealvarfpaqde
livitdifagsvnnefvrflsrphfhllsglnlpliidllisaaednteklitealtnak
esiqycnqtia

Timeline for d3mtqb1:

• d3mtqb1 first appeared in SCOPe 2.03, called d3mtqb_
  
• d3mtqb1 appears in SCOPe 2.07