SCOPe 2.06: Domain d3mtqa1: 3mtq A:1-134

Lineage for d3mtqa1 (3mtq A:1-134)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.0: automated matches [191356] (1 protein)
   not a true family

6. Protein automated matches [190395] (7 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [225902] (1 PDB entry)

8. Domain d3mtqa1: 3mtq A:1-134 [213574]
   Other proteins in same PDB: d3mtqa2, d3mtqb2
   automated match to d3lfhe_

Details for d3mtqa1

PDB Entry: 3mtq, 1.7 Å

PDB Description: crystal structure of a putative phosphoenolpyruvate-dependent sugar phosphotransferase system (pts) permease (kpn_04802) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.70 a resolution

PDB Compounds: (A:) putative phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) permease

SCOPe Domain Sequences for d3mtqa1:

Sequence; same for both SEQRES and ATOM records:

>d3mtqa1 c.54.1.0 (A:1-134) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mkrhyifashgsfangllnsvelilgkqpdihtlcayveeevdltqqvealvarfpaqde
livitdifagsvnnefvrflsrphfhllsglnlpliidllisaaednteklitealtnak
esiqycnqtiasam

Timeline for d3mtqa1:

• d3mtqa1 first appeared in SCOPe 2.03, called d3mtqa_
  
• d3mtqa1 was called d3mtqa_ in SCOPe 2.05
  
• d3mtqa1 appears in SCOPe 2.07
  
• d3mtqa1 appears in the current release, SCOPe 2.08