Lineage for d3mtqa1 (3mtq A:1-134)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121987Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2121988Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 2122019Family c.54.1.0: automated matches [191356] (1 protein)
    not a true family
  6. 2122020Protein automated matches [190395] (7 species)
    not a true protein
  7. 2122033Species Klebsiella pneumoniae [TaxId:272620] [225902] (1 PDB entry)
  8. 2122034Domain d3mtqa1: 3mtq A:1-134 [213574]
    Other proteins in same PDB: d3mtqa2, d3mtqb2
    automated match to d3lfhe_

Details for d3mtqa1

PDB Entry: 3mtq (more details), 1.7 Å

PDB Description: crystal structure of a putative phosphoenolpyruvate-dependent sugar phosphotransferase system (pts) permease (kpn_04802) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.70 a resolution
PDB Compounds: (A:) putative phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) permease

SCOPe Domain Sequences for d3mtqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mtqa1 c.54.1.0 (A:1-134) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mkrhyifashgsfangllnsvelilgkqpdihtlcayveeevdltqqvealvarfpaqde
livitdifagsvnnefvrflsrphfhllsglnlpliidllisaaednteklitealtnak
esiqycnqtiasam

SCOPe Domain Coordinates for d3mtqa1:

Click to download the PDB-style file with coordinates for d3mtqa1.
(The format of our PDB-style files is described here.)

Timeline for d3mtqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mtqa2