SCOPe 2.04: Domain d3mtfb_: 3mtf B:

Lineage for d3mtfb_ (3mtf B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries)

8. Domain d3mtfb_: 3mtf B: [213573]
   automated match to d3tzma_
   complexed with a3f, edo, po4

Details for d3mtfb_

PDB Entry: 3mtf, 2.15 Å

PDB Description: Crystal structure of the ACVR1 kinase in complex with a 2-aminopyridine inhibitor

PDB Compounds: (B:) Activin receptor type-1

SCOPe Domain Sequences for d3mtfb_:

Sequence; same for both SEQRES and ATOM records:

>d3mtfb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrhen
ilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhi
eifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkry
mapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsf
edmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltkid

Timeline for d3mtfb_:

• d3mtfb_ first appeared in SCOPe 2.03
  
• d3mtfb_ appears in SCOPe 2.05
  
• d3mtfb_ appears in the current release, SCOPe 2.08