Lineage for d3mtfb_ (3mtf B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (20 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (770 PDB entries)
  8. 2545573Domain d3mtfb_: 3mtf B: [213573]
    automated match to d3tzma_
    complexed with a3f, edo, po4

Details for d3mtfb_

PDB Entry: 3mtf (more details), 2.15 Å

PDB Description: Crystal structure of the ACVR1 kinase in complex with a 2-aminopyridine inhibitor
PDB Compounds: (B:) Activin receptor type-1

SCOPe Domain Sequences for d3mtfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mtfb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrhen
ilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhi
eifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkry
mapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsf
edmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltkid

SCOPe Domain Coordinates for d3mtfb_:

Click to download the PDB-style file with coordinates for d3mtfb_.
(The format of our PDB-style files is described here.)

Timeline for d3mtfb_: