Lineage for d3mtfa_ (3mtf A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931583Protein automated matches [190091] (12 species)
    not a true protein
  7. 1931656Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries)
  8. 1931998Domain d3mtfa_: 3mtf A: [213572]
    automated match to d3tzma_
    complexed with a3f, edo, po4

Details for d3mtfa_

PDB Entry: 3mtf (more details), 2.15 Å

PDB Description: Crystal structure of the ACVR1 kinase in complex with a 2-aminopyridine inhibitor
PDB Compounds: (A:) Activin receptor type-1

SCOPe Domain Sequences for d3mtfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mtfa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvarditllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrheni
lgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhie
ifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkrym
apevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsfe
dmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki

SCOPe Domain Coordinates for d3mtfa_:

Click to download the PDB-style file with coordinates for d3mtfa_.
(The format of our PDB-style files is described here.)

Timeline for d3mtfa_: