SCOPe 2.08: Domain d3mqwb1: 3mqw B:1-127

Lineage for d3mqwb1 (3mqw B:1-127)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (4 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.0: automated matches [191544] (1 protein)
   not a true family

6. Protein automated matches [190935] (24 species)
   not a true protein

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [225891] (1 PDB entry)

8. Domain d3mqwb1: 3mqw B:1-127 [213563]
   Other proteins in same PDB: d3mqwa2, d3mqwb2, d3mqwc2, d3mqwd2, d3mqwe2, d3mqwf2
   automated match to d3v4dc_
   complexed with flc, gol, so4

Details for d3mqwb1

PDB Entry: 3mqw, 1.8 Å

PDB Description: Crystal structure of a putative endoribonuclease L-PSP from Entamoeba histolytica with higher solvent content and an ordered N-terminal tag

PDB Compounds: (B:) putative Endoribonuclease L-PSP

SCOPe Domain Sequences for d3mqwb1:

Sequence; same for both SEQRES and ATOM records:

>d3mqwb1 d.79.1.0 (B:1-127) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
mskltvvasplapeavgaysqaiicngmvycsgqigldrktgdfagktieeqskqvmtnl
kyvleeagssmdkvvkttclladikdfgvfngiyaeafgnhkparacfaaaalpkgalve
veciatl

Timeline for d3mqwb1:

• d3mqwb1 first appeared in SCOPe 2.03, called d3mqwb_
  
• d3mqwb1 appears in SCOPe 2.07