| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.1.0: automated matches [191544] (1 protein) not a true family |
| Protein automated matches [190935] (24 species) not a true protein |
| Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [225891] (1 PDB entry) |
| Domain d3mqwa1: 3mqw A:1-127 [213562] Other proteins in same PDB: d3mqwa2, d3mqwb2, d3mqwc2, d3mqwd2, d3mqwe2, d3mqwf2 automated match to d3v4dc_ complexed with flc, gol, so4 |
PDB Entry: 3mqw (more details), 1.8 Å
SCOPe Domain Sequences for d3mqwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mqwa1 d.79.1.0 (A:1-127) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
mskltvvasplapeavgaysqaiicngmvycsgqigldrktgdfagktieeqskqvmtnl
kyvleeagssmdkvvkttclladikdfgvfngiyaeafgnhkparacfaaaalpkgalve
veciatl
Timeline for d3mqwa1: